BLAST >sp Q56686 CPDP_ALIFS 3',5'-cyclic-nucleotide phosphodiesterase OS=Aliivibrio fischeri OX=668 GN=cpdP PE=3 SV=1 MFKNKLAVLFTCLSVFSFSAQSGSFDTVTLGSKGGIQDGNLTAFLIKSEADSNFVMLDAG SVVNGLIVSEQKGAFKDITVPDSSPYTKVGYLLKDRIKGYFISHAHLDHVAGLIISSPDD SKKPIYGLAATNKDLMKNYFNWSAWPNFGNKGEGFKLNKYNYVDLQPGVWSPVAETTMSV VSLPLSHSGGQSTVFILKDSEGDVFAYFGDTGPDEVEKSSAMRTAWSVLAPFVKQGKLKG IIIEVSFTNETPDKSLFGHLTPNWLVKELSVLEDMNGKGSLKDLNVAISHIKYSLKNSED PKVIIKKQLVEVNDLGVNFIFPEQGDSLQF Align Format Add to basket Added to basket History. Annotation score: Annotation score:2 out of 5 The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.More. -Protein inferred from homology i This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.More. This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.More.Names & Taxonomy i This subsection of the Names and taxonomy section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.More.Protein names i.
CAS LX 522 Syntax I Islands and phases. Phases are CP and DP.! A feature outside of a phase cannot match a feature further inside the phase than its specifier.!
Name: cpdP This subsection of the Names and taxonomy section provides information on the name(s) of the organism that is the source of the protein sequence.More.Organism i This subsection of the Names and taxonomy section shows the unique identifier assigned by the NCBI to the source organism of the protein. Altami studio kryak. This is known as the ‘taxonomic identifier’ or ‘taxid’.More.Taxonomic identifier i [] This subsection of the Names and taxonomy section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.More.Taxonomic lineage i › › › › › ›. This section describes post-translational modifications (PTMs) and/or processing events.More.PTM / Processing i Molecule processing Feature key Position(s) Description Actions Graphical view Length This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.More.Signal peptide i Sequence analysis 22 This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.More.Chain i PRO_ 3',5'-cyclic-nucleotide phosphodiesterase 308. Belongs to the.